PATE4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PATE4 Antibody is: synthetic peptide directed towards the middle region of Human PATE4. Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	prostate and testis expressed 4
Database Link	NP_001138346 Entrez Gene 399968 Human UniProt ID P0C8F1
Background	PATE4 may modulate the function of nicotinic acetylcholine receptors and may enhance sperm motility.
Synonyms	PATE-B
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.