PLET1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C11orf34 Antibody is: synthetic peptide directed towards the middle region of Human C11orf34. Synthetic peptide located within the following region: NSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	placenta expressed transcript 1
Database Link	NP_001138496 Entrez Gene 349633 Human UniProt ID Q6UQ28
Background	C11orf34 may participate in the wound response during the healing process, and promote wound repair.
Synonyms	C11orf34
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.