ZFAT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZFAT1 Antibody: synthetic peptide directed towards the middle region of human ZFAT1. Synthetic peptide located within the following region: KHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	94 kDa
Gene Name	zinc finger and AT-hook domain containing
Database Link	NP_001167629 Entrez Gene 57623 Human UniProt ID Q9P243
Background	ZFAT1 may be involved in transcriptional regulation. Overexpression of ZFAT1causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated.
Synonyms	AITD3; ZFAT1; ZNF406
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.