HDAC4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB, ChIP
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	118 kDa
Gene Name	histone deacetylase 4
Database Link	NP_006028 Entrez Gene 208727 MouseEntrez Gene 9759 Human UniProt ID P56524
Background	Hdac4 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D.
Synonyms	AHO3; BDMR; HA6116; HD4; HDAC-4; HDAC-A; HDACA
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93%; Guinea pig: 93%; Mouse: 86%; Yeast: 82%; Horse: 77%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.