Influenza Virus NS1A Binding Protein (IVNS1ABP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IVNS1ABP Antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP. Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	influenza virus NS1A binding protein
Database Link	NP_006460 Entrez Gene 10625 Human UniProt ID Q9Y6Y0
Background	IVNS1ABP is a novel human protein that interacts with the influenza A virus. Nonstructural NS1 protein is relocalized in the nuclei of infected cells.
Synonyms	FLARA3; HSPC068; KLHL39; ND1; NS-1; NS1-BP; NS1BP
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.