AP4B1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AP4B1 Antibody is: synthetic peptide directed towards the C-terminal region of Human AP4B1. Synthetic peptide located within the following region: GAERCDPELPKTSSFAASGPLIPEENKERVQELPDSGALMLVPNRQLTAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	adaptor related protein complex 4 beta 1 subunit
Database Link	NP_006585 Entrez Gene 10717 Human UniProt ID Q9Y6B7
Background	The function of this protein remains unknown.
Synonyms	BETA-4; CPSQ5; SPG47
Note	Immunogen sequence homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Protein Pathways	Lysosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.