Keratin 38 (KRT38) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KRT38 Antibody is: synthetic peptide directed towards the N-terminal region of Human KRT38. Synthetic peptide located within the following region: AYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERSKCH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	keratin 38
Database Link	NP_006762 Entrez Gene 8687 Human UniProt ID O76015
Background	The protein encoded by this gene is a member of the keratin gene family. As a type I hair keratin, it is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription.
Synonyms	HA8; hHa8; KRTHA8
Note	Immunogen sequence homology: Human: 100%; Rabbit: 93%; Horse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.