CCDC59 Rabbit Polyclonal Antibody
CAT#: TA331982
Rabbit Polyclonal Anti-CCDC59 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CCDC59 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC59. Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | coiled-coil domain containing 59 |
Database Link | |
Background | CCDC59 is a component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). It enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities. |
Synonyms | BR22; HSPC128; TAP26 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Dog: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |