IST1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-IST1 Antibody is: synthetic peptide directed towards the C-terminal region of Human IST1. Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	IST1, ESCRT-III associated factor
Database Link	NP_055576 Entrez Gene 9798 Human UniProt ID P53990
Background	IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvment in the MVB pathway is not established. IST1 is involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells.
Synonyms	OLC1
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.