PMPCA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	peptidase, mitochondrial processing alpha subunit
Database Link	NP_055975 Entrez Gene 23203 Human UniProt ID Q10713
Background	PMPCA cleaves presequences (transit peptides) from mitochondrial protein precursors.
Synonyms	Alpha-MPP; INPP5E; P-55; SCAR2
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Horse: 92%; Bovine: 86%; Pig: 79%; Guinea pig: 79%; Dog: 77%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.