LEPROTL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LEPROTL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	leptin receptor overlapping transcript-like 1
Database Link	NP_056159 Entrez Gene 23484 Human UniProt ID O95214
Background	LEPROTL1 negatively regulates growth hormone (GH) receptor cell surface expression in liver. It may play a role in liver resistance to GH during periods of reduced nutrient availability.
Synonyms	HSPC112; my047; Vps55
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.