C1RL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C1RL Antibody is: synthetic peptide directed towards the middle region of Human C1RL. Synthetic peptide located within the following region: KVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	complement C1r subcomponent like
Database Link	NP_057630 Entrez Gene 51279 Human UniProt ID Q9NZP8
Background	C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum.
Synonyms	C1r-LP; C1RL1; C1RLP; CLSPa
Note	Immunogen sequence homology: Human: 100%; Mouse: 90%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.