CHRAC1 Rabbit Polyclonal Antibody

CAT#: TA331896

Rabbit Polyclonal Anti-CHRAC1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of chromatin accessibility complex 1 (CHRAC1), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CHRAC1 Antibody: synthetic peptide directed towards the N terminal of human CHRAC1. Synthetic peptide located within the following region: SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 15 kDa
Gene Name chromatin accessibility complex 1
Background CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. [supplied by OMIM]
Synonyms CHARC1; CHARC15; CHRAC-1; CHRAC-15; CHRAC15; YCL1
Note Immunogen sequence homology: Human: 100%; Rat: 92%; Horse: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...