TRIT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TRIT1 Antibody: synthetic peptide directed towards the middle region of human TRIT1. Synthetic peptide located within the following region: PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	tRNA isopentenyltransferase 1
Database Link	NP_060116 Entrez Gene 54802 Human UniProt ID Q9H3H1
Background	TRIT1 is responsible for the modification of A37 to isopentenyl A37 of both cytosolic and mitochondrial tRNAs.
Synonyms	GRO1; hGRO1; IPPT; IPT; IPTase; MOD5
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 92%; Guinea pig: 92%
Reference Data
Protein Pathways	Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.