DEF8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DEF8 Antibody is: synthetic peptide directed towards the N-terminal region of Human DEF8. Synthetic peptide located within the following region: PFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	differentially expressed in FDCP 8 homolog (mouse)
Database Link	NP_060172 Entrez Gene 54849 Human UniProt ID Q6ZN54
Background	The function of this protein remains unknown.
Synonyms	FLJ20186; MGC104349
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.