PGPEP1 Rabbit Polyclonal Antibody
CAT#: TA331888
Rabbit Polyclonal Anti-PGPEP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PGPEP1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PGPEP1. Synthetic peptide located within the following region: KHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | pyroglutamyl-peptidase I |
Database Link | |
Background | Pyroglutamyl peptidase I catalyzes the hydrolysis of N-terminal pyroglutamyl residues from oligopeptides and proteins. |
Synonyms | PAP-I; Pcp; PGI; PGP; PGP-I; PGPI |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |