C12orf48 (PARPBP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PARPBP Antibody is: synthetic peptide directed towards the C-terminal region of Human PARPBP. Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	PARP1 binding protein
Database Link	NP_060385 Entrez Gene 55010 Human UniProt ID Q9NWS1
Background	PARPBP is required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. PARPBP antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologous recombination structure. It binds single-strand DNA and poly(A) homopolymers and positively regulate the poly(ADP-ribosyl)ation activity of PARP1; however such function may be indirect.
Synonyms	AROM; C12orf48; PARI
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Pig: 92%; Rabbit: 86%; Horse: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.