EXD2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EXD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human EXD2. Synthetic peptide located within the following region: SNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	exonuclease 3'-5' domain containing 2
Database Link	NP_060669 Entrez Gene 55218 Human UniProt ID Q9NVH0
Background	The function of this protein remains unknown.
Synonyms	C14orf114; EXDL2
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.