YOD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-YOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human YOD1. Synthetic peptide located within the following region: ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	YOD1 deubiquitinase
Database Link	NP_061036 Entrez Gene 55432 Human UniProt ID Q5VVQ6
Background	Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA8 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Synonyms	DUBA8; OTUD2; PRO0907
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Mouse: 86%
Reference Data
Protein Pathways	Biosynthesis of unsaturated fatty acids, Limonene and pinene degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.