ZNF395 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF395 Antibody: synthetic peptide directed towards the middle region of human ZNF395. Synthetic peptide located within the following region: SGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc finger protein 395
Database Link	NP_061130 Entrez Gene 55893 Human UniProt ID Q9H8N7
Background	ZNF395 is a novel transcription factor shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells. ZNF395 might play a role in transcription of PV genes and in E2-mediated repression.
Synonyms	HDBP-2; HDBP2; HDRF-2; PBF; PRF-1; PRF1; Si-1-8-14
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.