GPR162 Rabbit Polyclonal Antibody
CAT#: TA331838
Rabbit Polyclonal Anti-GPR162 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GPR162 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR162. Synthetic peptide located within the following region: ILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTFAVVQLRRQASSDYD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | G protein-coupled receptor 162 |
Database Link | |
Background | This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Synonyms | A-2; GRCA |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 79%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |