GPR158 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GPR158 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR158. Synthetic peptide located within the following region: LPPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	133 kDa
Gene Name	G protein-coupled receptor 158
Database Link	NP_065803 Entrez Gene 57512 Human UniProt ID Q5T848
Background	GPR158 is a orphan receptor.
Synonyms	RP11-59G22.1
Note	Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.