ZNF398 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF398 Antibody: synthetic peptide directed towards the middle region of human ZNF398. Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	zinc finger protein 398
Database Link	NP_065832 Entrez Gene 57541 Human UniProt ID Q8TD17
Background	ZNF398 is a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. This protein acts as a transcriptional activator.This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined.
Synonyms	P51; P71; ZER6
Note	Immunogen sequence homology: Human: 100%; Rat: 93%; Rabbit: 93%; Mouse: 86%; Horse: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.