OSGEPL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-OSGEPL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OSGEPL1. Synthetic peptide located within the following region: IMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	O-sialoglycoprotein endopeptidase-like 1
Database Link	NP_071748 Entrez Gene 64172 Human UniProt ID Q9H4B0
Background	OSGEPL1 is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine.
Synonyms	OSGEPL; Qri7
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 92%; Guinea pig: 91%; Mouse: 85%; Rat: 77%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.