PTCD2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PTCD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PTCD2. Synthetic peptide located within the following region: AVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	pentatricopeptide repeat domain 2
Database Link	NP_079030 Entrez Gene 79810 Human UniProt ID Q8WV60
Background	PTCD2 is involved in mitochondrial RNA maturation and mitochondrial respiratory chain function.
Synonyms	FLJ12598
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 91%; Pig: 90%; Mouse: 90%; Guinea pig: 90%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.