PREX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PREX2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PREX2. Synthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	182 kDa
Gene Name	phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 2
Database Link	NP_079146 Entrez Gene 80243 Human UniProt ID Q70Z35
Background	PREX2 functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol 3,4,5-trisphosphate and the beta gamma subunits of heterotrimeric G protein. PREX2 mediates the activation of RAC1 in a PI3K-dependent manner. PREX2 may be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase.
Synonyms	DEP.2; DEPDC2; P-REX2; PPP1R129
Note	Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.