RHOXF2 Rabbit Polyclonal Antibody
CAT#: TA331692
Rabbit Polyclonal Anti-RHOXF2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RHOXF2 Antibody: synthetic peptide directed towards the middle region of human RHOXF2. Synthetic peptide located within the following region: DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | Rhox homeobox family member 2 |
Database Link | |
Background | RHOXF2 belongs to the paired-like homeobox family, PEPP subfamily. It contains 1 homeobox DNA-binding domain. The function of RHOXF2 remains unknown. |
Synonyms | CT107; PEPP-2; PEPP2; THG1 |
Note | Immunogen sequence homology: Human: 100%; Pig: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |