PLEKHG4B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PLEKHG4B Antibody is: synthetic peptide directed towards the C-terminal region of Human PLEKHG4B. Synthetic peptide located within the following region: HVFLFEDLILFSKTQKVEGSHDVYLYKQSFKTAEIGMTENVGDSGLRFEI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	139 kDa
Gene Name	pleckstrin homology and RhoGEF domain containing G4B
Database Link	NP_443141 Entrez Gene 153478 Human UniProt ID Q96PX9
Background	The function of this protein remains unknown.
Synonyms	FLJ43173; KIAA1909
Note	Immunogen sequence homology: Human: 100%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.