SCAND3 (ZBED9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF452 Antibody: synthetic peptide directed towards the n terminal of human ZNF452. Synthetic peptide located within the following region: EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	152 kDa
Gene Name	zinc finger BED-type containing 9
Database Link	NP_443155 Entrez Gene 114821 Human UniProt ID Q6R2W3
Background	ZNF452 (SCAND3) contains 1 integrase catalytic domain and 1 SCAN box domain. The function of ZNF452 remains unknown.
Synonyms	Buster4; dJ1186N24.3; SCAND3; ZFP38-L; ZNF305P2; ZNF452
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 92%; Mouse: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.