ATP6V0E2 Rabbit Antibody

Specifications

Product Data
Reactivity	Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish
Host	Rabbit
Immunogen	The immunogen for Anti-ATP6V0E2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ATP6V0E2. Synthetic peptide located within the following region: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Database Link	NP_660265 Entrez Gene 155066 Human
Background	Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component.
Synonyms	ATP6V0E2L; C7orf32
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Pathways	Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.