PLD5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PLD5 Antibody is: synthetic peptide directed towards the C-terminal region of Human PLD5. Synthetic peptide located within the following region: AGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	phospholipase D family member 5
Database Link	NP_689879 Entrez Gene 200150 Human UniProt ID Q8N7P1
Background	The function of this protein remains unknown.
Synonyms	PLDC
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 92%; Mouse: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.