SPATIAL (TBATA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TBATA Antibody is: synthetic peptide directed towards the C-terminal region of Human TBATA. Synthetic peptide located within the following region: EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	thymus, brain and testes associated
Database Link	NP_689923 Entrez Gene 219793 Human UniProt ID Q96M53
Background	TBATA may play a role in spermatid differentiation. It modulates thymic stromal cell proliferation and thymus function.
Synonyms	C10orf27; SPATIAL
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.