CD300LB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CD300LB Antibody is: synthetic peptide directed towards the middle region of Human CD300LB. Synthetic peptide located within the following region: CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	CD300 molecule like family member b
Database Link	NP_777552 Entrez Gene 124599 Human UniProt ID A8K4G0
Background	CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells.
Synonyms	CD300b; CLM-7; CLM7; CMRF35-A2; IREM-3; IREM3; TREM-5; TREM5
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.