PDILT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PDILT Antibody is: synthetic peptide directed towards the C-terminal region of Human PDILT. Synthetic peptide located within the following region: PEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	protein disulfide isomerase like, testis expressed
Database Link	NP_777584 Entrez Gene 204474 Human UniProt ID Q8N807
Background	PDILT is a probable redox-inactive chaperone involved in spermatogenesis.
Synonyms	PDIA7
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.