CCDC39 Rabbit Antibody

Specifications

Product Data
Reactivity	Human, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Bovine
Host	Rabbit
Immunogen	The immunogen for Anti-CCDC39 Antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC39. Synthetic peptide located within the following region: QELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILE
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Database Link	NP_852091 Entrez Gene 339829 Human
Background	The function of this protein remains unknown.
Synonyms	CILD14; FAP59
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.