TBC1D9B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TBC1D9B Antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D9B. Synthetic peptide located within the following region: SFEQILASILTESVLVNFFEKRVDIGLKIKDQKKVERQFSTASDHEQPGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	TBC1 domain family member 9B
Database Link	NP_942568 Entrez Gene 23061 Human UniProt ID Q66K14
Background	The function of this protein remains unknown.
Synonyms	GRAMD9B
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.