Tppp Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tppp antibody: synthetic peptide directed towards the C terminal of mouse 2900041A09RIK. Synthetic peptide located within the following region: KAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	tubulin polymerization promoting protein
Database Link	NP_878259 Entrez Gene 11076 Human UniProt ID Q7TQD2
Background	This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Synonyms	p24; p25; p25-alpha; p25alpha; TPPP/p25; TPPP1
Note	Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Horse: 92%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.