CEP63 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CEP63 antibody is: synthetic peptide directed towards the N-terminal region of Human CEP63. Synthetic peptide located within the following region: YEKLQKKQMREFRGNTKNHREDRSEIERLTAKIEEFRQKSLDWEKQRLIY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	centrosomal protein 63
Database Link	NP_001035842 Entrez Gene 80254 Human UniProt ID Q96MT8
Background	This gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. Several alternatively spliced transcript variants have been found, but their biological validity has not been determined.
Synonyms	SCKL6
Note	Pig: 100%; Human: 100%; Dog: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.