PPFIA4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PPFIA4 antibody is: synthetic peptide directed towards the N-terminal region of Human PPFIA4. Synthetic peptide located within the following region: AQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	PTPRF interacting protein alpha 4
Database Link	NP_055868 Entrez Gene 8497 Human UniProt ID O75335
Background	PPFIA4, or liprin-alpha-4, belongs to the liprin-alpha gene family. See liprin-alpha-1 (LIP1, or PPFIA1; MIM 611054) for background on liprins.
Synonyms	alpha 4; f polypeptide (PTPRF); interacting protein (liprin); Liprin-alpha4; liprin alpha4; protein tyrosine phosphatase; receptor type
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Phosphatase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.