PLSCR4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PLSCR4 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSCR4. Synthetic peptide located within the following region: HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	phospholipid scramblase 4
Database Link	NP_065086 Entrez Gene 57088 Human UniProt ID Q9NRQ2
Background	PLSCR4 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR4 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Synonyms	TRA1
Note	Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.