fast skeletal Myosin (MYLPF) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MYLPF antibody is: synthetic peptide directed towards the C-terminal region of Human MYLPF. Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	myosin light chain, phosphorylatable, fast skeletal muscle
Database Link	NP_037424 Entrez Gene 29895 Human UniProt ID Q96A32
Background	The function of this protein remains unknown.
Synonyms	HUMMLC2B; MLC2B; MRLC2; MYL11
Note	Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Protein Pathways	Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.