GSDMA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GSDMA antibody is: synthetic peptide directed towards the C-terminal region of Human GSDMA. Synthetic peptide located within the following region: ICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	gasdermin A
Database Link	NP_835465 Entrez Gene 284110 Human UniProt ID Q96QA5
Background	GSDMA induces apoptosis.
Synonyms	FKSG9; GSDM; GSDM1
Note	Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.