SP140 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SP140 antibody: synthetic peptide directed towards the N terminal of human SP140. Synthetic peptide located within the following region: PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	SP140 nuclear body protein
Database Link	NP_001005176 Entrez Gene 11262 Human UniProt ID Q13342
Background	SP140 is the nuclear body protein found specifically in all NP cells. HIV-1 infection induced its partial dispersal from nuclear bodies into cytosolic colocalization with Vif.
Synonyms	LYSP100; LYSP100-A; LYSP100-B
Note	Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rat: 77%; Mouse: 77%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.