iASPP (PPP1R13L) Rabbit Polyclonal Antibody

CAT#: TA331182

Rabbit Polyclonal Anti-PPP1R13L Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 13 like (PPP1R13L), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications IF, WB
Recommend Dilution WB, IF
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PPP1R13L antibody: synthetic peptide directed towards the middle region of human PPP1R13L. Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 89 kDa
Gene Name protein phosphatase 1 regulatory subunit 13 like
Background IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53.IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms IASPP; NKIP1; RAI; RAI4
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...