ME1 Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ME1 antibody is: synthetic peptide directed towards the C-terminal region of Human ME1. Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | malic enzyme 1 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | HUMNDME; MES |
Note | Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Goat: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77% |
Reference Data | |
Protein Pathways | Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |