ME1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ME1 antibody is: synthetic peptide directed towards the C-terminal region of Human ME1. Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	malic enzyme 1
Database Link	NP_002386 Entrez Gene 4199 Human UniProt ID P48163
Background	The function of this protein remains unknown.
Synonyms	HUMNDME; MES
Note	Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Goat: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77%
Reference Data
Protein Pathways	Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.