CDX4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDX4 antibody: synthetic peptide directed towards the C terminal of human CDX4. Synthetic peptide located within the following region: KKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	caudal type homeobox 4
Database Link	NP_005184 Entrez Gene 1046 Human UniProt ID O14627
Background	CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes.
Synonyms	caudal type homeobox 4; caudal type homeo box transcription factor 4; caudal type homeobox transcription factor 4; OTTHUMP00000023566
Note	Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.