ZNF391 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF391 antibody: synthetic peptide directed towards the middle region of human ZNF391. Synthetic peptide located within the following region: HTQERPYKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFSWISSL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	zinc finger protein 391
Database Link	NP_001070249 Entrez Gene 346157 Human UniProt ID Q9UJN7
Background	ZNF391 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZNF391 may be involved in transcriptional regulation.
Synonyms	dJ153G14.3
Note	Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 91%; Mouse: 91%; Rabbit: 91%; Guinea pig: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.