LRRC8A Rabbit Polyclonal Antibody

CAT#: TA331090

Rabbit polyclonal Anti-LRRC8A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1
    • 100 ug

CNY 4,840.00


Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-LRRC8A antibody: synthetic peptide directed towards the middle region of human LRRC8A. Synthetic peptide located within the following region: NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 94 kDa
Gene Name leucine-rich repeat containing 8 family member A
Background LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.
Synonyms AGM5; LRRC8; SWELL1
Note Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Rabbit: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...