C9ORF46 (PLGRKT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	plasminogen receptor with a C-terminal lysine
Database Link	NP_060935 Entrez Gene 55848 Human UniProt ID Q9HBL7
Background	The exact function of C9orf46 remains unknown.
Synonyms	AD025; C9orf46; MDS030; Plg-R(KT); PLG-RKT
Note	Human: 100%; Rat: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.