ALG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ALG1 antibody is: synthetic peptide directed towards the C-terminal region of Human ALG1. Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Database Link	NP_061982 Entrez Gene 56052 Human UniProt ID Q9BT22
Background	The function of this protein remains unknown.
Synonyms	CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
Note	Human: 100%; Dog: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, N-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.